PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G66700.1
Common NameATHB53, ATHB-53, HB53, HB-8, MSN2.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 228aa    MW: 26391.6 Da    PI: 5.7329
Description homeobox 53
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G66700.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1972125457
                  -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  ++++t+eq++ Le  F +++++   ++e++A +lgL+ rqV vWFqNrRa++k+
  AT5G66700.1  72 KRKLTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKN 125
                  4589************************************************95 PP

2HD-ZIP_I/II119.61.7e-3871162293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +kr+l++eqv++LE sF +e+kLe+ rK+++a eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++d+++  +++Le++  +L+e+l+e
  AT5G66700.1  71 RKRKLTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNKKLEEEYAKLKNHHDNVVLGQCQLESQILKLTEQLSE 162
                  8***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.2E-1769130IPR001356Homeobox domain
SuperFamilySSF466892.21E-1770128IPR009057Homeodomain-like
CDDcd000864.83E-1571127No hitNo description
PROSITE profilePS5007115.95371126IPR001356Homeobox domain
PfamPF000461.1E-1672125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-2073133IPR009057Homeodomain-like
PRINTSPR000312.3E-597106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000312.3E-5106122IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0006085anatomyroot meristem
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025181anatomyroot elongation zone
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MDHGRLMDDQ MMLGSQVYPY TTQPQNSHCI IVNQIDGGEE SKPVKRRRKR RSKGSSATNE  60
EDVAEIGGML RKRKLTDEQV NMLEYSFGNE HKLESGRKEK IAGELGLDPR QVAVWFQNRR  120
ARWKNKKLEE EYAKLKNHHD NVVLGQCQLE SQILKLTEQL SEAQSEIRKL SERLEEMPTN  180
SSSSSLSVEA NNAPTDFELA PETNYNIPFY MLDNNYLQSM EYWDGLYV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14450KRRRKRR
26974LRKRKL
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247052_at0.0
Expression AtlasAT5G66700-
AtGenExpressAT5G66700-
ATTED-IIAT5G66700-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root meristem, late flowers and siliques. {ECO:0000269|PubMed:15567172, ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain protein. Member of HD-ZIP 1 family, most closely related to HB5. AtHB53 is auxin-inducible and its induction is inhibited by cytokinin, especially in roots therefore may be involved in root development.
UniProtProbable transcription factor that may play a regulatory role in auxin/cytokinin signaling during root development. {ECO:0000269|PubMed:15567172}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00591DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G66700.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA), by salt stress, by indole-3-acetic acid (IAA) and during darkness conditions. Down-regulated by cytokinin. {ECO:0000269|PubMed:15567172, ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G66700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6834770.0AY683477.1 Arabidopsis thaliana homeodomain protein (HB53) mRNA, complete cds.
GenBankBT0248470.0BT024847.1 Arabidopsis thaliana At5g66700 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201471.11e-172homeobox-leucine zipper protein ATHB-53
SwissprotQ9LVR01e-174ATB53_ARATH; Homeobox-leucine zipper protein ATHB-53
TrEMBLD7MME01e-143D7MME0_ARALL; Putative uncharacterized protein
STRINGAT5G66700.11e-171(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM126021731
Representative plantOGRP37761025
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  3. Son O, et al.
    Induction of a homeodomain-leucine zipper gene by auxin is inhibited by cytokinin in Arabidopsis roots.
    Biochem. Biophys. Res. Commun., 2005. 326(1): p. 203-9
    [PMID:15567172]
  4. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  5. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]